PGM2L1 Antibody - N-terminal region : Biotin

PGM2L1 Antibody - N-terminal region : Biotin
SKU
AVIARP55658_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PGM2L1 is the Glucose 1,6-bisphosphate synthase using 1,3-bisphosphoglycerate as a phosphate donor and a series of 1-phosphate sugars as acceptors, including glucose 1-phosphate, mannose 1-phosphate, ribose 1-phosphate and deoxyribose 1-phosphate. 5 or 6-phosphosugars are bad substrates, with the exception of glucose 6-phosphate. PGM2L1 also synthesizes ribose 1,5-bisphosphate. PGM2L1 has only low phosphopentomutase and phosphoglucomutase activities.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PGM2L1

Key Reference: Maliekal,P., (2007) J. Biol. Chem. 282 (44), 31844-31851

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glucose 1,6-bisphosphate synthase

Protein Size: 622

Purification: Affinity Purified
More Information
SKU AVIARP55658_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55658_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 283209
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×