Phactr3 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: VTTVHRPLPPSRVMEELHRALATKHRQDSFQGRECRGSPKKRMDVRLSRT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphatase and actin regulator 3 EMBL CAM15805.1

Protein Size: 518

Purification: Affinity Purified

• SKU: AVIARP53446_P050FITC
• Manufacturer: Aviva Systems Biology
• Manufacturer SKU: ARP53446_P050-FITC
• Package Unit: 100μl
• Quantity Unit: STK
• Reactivity: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Clonality: Polyclonal
• Application: Western Blotting
• Human Gene ID: 74189
• Host: Rabbit
• Conjugate: Conjugated, FITC