PIAS2 Antibody - N-terminal region : Biotin

PIAS2 Antibody - N-terminal region : Biotin
SKU
AVIARP53840_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Pias2 functions as an E3-type small ubiquitin-like modifier (SUMO) ligase, stabilizing the interaction between UBE2I and the substrate, and as a SUMO-tethering factor. It plays a crucial role as a transcriptional coregulation in various cellular pathways, including the STAT pathway, the p53 pathway and the steroid hormone signaling pathway. It seems to be mostly involved in gene silencing. It binds to sumoylated ELK1 and enhances its transcriptional activity by preventing recruitment of HDAC2 by ELK1, thus reversing SUMO-mediated repression of ELK1 transactivation activity. This gene encodes a protein involved in the regulation of transcription factors involved in MAP kinase signaling. The symbol MIZ1 has also been associated with ZBTB17 which is a different gene located on chromosome 1. Two alternatively spliced transcripts encoding different isoforms have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIAS2

Key Reference: Tsang,H.T., (2006) Genomics 88 (3), 333-346

Molecular Weight: 63kDa

Peptide Sequence: Synthetic peptide located within the following region: RELYRRRYPRTLEGLSDLSTIKSSVFSLDGGSSPVEPDLAVAGIHSLPST

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: E3 SUMO-protein ligase PIAS2

Protein Size: 572

Purification: Affinity Purified
More Information
SKU AVIARP53840_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53840_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 9063
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×