PIK3R5 Antibody - N-terminal region : FITC

PIK3R5 Antibody - N-terminal region : FITC
SKU
AVIARP55011_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit.Receptor-regulated class I phosphoinositide 3-kinases (PI3Ks) phosphorylate the membrane lipid phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2) to PtdIns(3,4,5)P3, which in turn recruits and activates cytosolic effectors involved in proliferation, survival, or chemotaxis. PIK3R5 is a PI3K regulatory subunit (Brock et al., 2003 [PubMed 12507995]).[supplied by OMIM]. Sequence Note: removed 2 bases from the 3' end that did not align to the reference genome assembly. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-3253 AF128881.1 1-3253

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIK3R5

Key Reference: Johnson,C., (2007) Oncogene 26 (49), 7049-7057

Molecular Weight: 97kDa

Peptide Sequence: Synthetic peptide located within the following region: HRFLTWPVPYCSICQELLTFIDAELKAPGISYQRLVRAEQGLPIRSHRSS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoinositide 3-kinase regulatory subunit 5

Protein Size: 880

Purification: Affinity Purified

Subunit: 5
More Information
SKU AVIARP55011_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55011_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 23533
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×