PIN4 Antibody - middle region : FITC

PIN4 Antibody - middle region : FITC
SKU
AVIARP56688_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ri

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PIN4

Key Reference: Kessler,D., (er) BMC Biol. 5, 37 (2007)

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: LGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4

Protein Size: 156

Purification: Affinity Purified
More Information
SKU AVIARP56688_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56688_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5303
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×