PIN4 Antibody - N-terminal region : Biotin

PIN4 Antibody - N-terminal region : Biotin
SKU
AVIARP56687_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ri

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIN4

Key Reference: Kessler,D., (er) BMC Biol. 5, 37 (2007)

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSAD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4

Protein Size: 156

Purification: Affinity Purified
More Information
SKU AVIARP56687_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56687_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5303
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×