PIN4 Antibody - N-terminal region : HRP

PIN4 Antibody - N-terminal region : HRP
SKU
AVIARP56687_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the parvulin subfamily of the peptidyl-prolyl cis/trans isomerase protein family. The encoded protein catalyzes the isomerization of peptidylprolyl bonds, and may play a role in the cell cycle, chromatin remodeling, and/or ri

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIN4

Key Reference: Kessler,D., (er) BMC Biol. 5, 37 (2007)

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSAD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Peptidyl-prolyl cis-trans isomerase NIMA-interacting 4

Protein Size: 156

Purification: Affinity Purified
More Information
SKU AVIARP56687_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56687_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5303
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×