PIWIL2 Antibody : Biotin

PIWIL2 Antibody : Biotin
SKU
AVIARP57108_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIWIL2

Key Reference: Lee,J.H., (2006) Hum. Mol. Genet. 15 (2), 201-211

Molecular Weight: 110kDa

Peptide Sequence: Synthetic peptide located within the following region: QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Piwi-like protein 2

Protein Size: 973

Purification: Affinity Purified
More Information
SKU AVIARP57108_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57108_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55124
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×