PLAT Antibody - middle region : FITC

PLAT Antibody - middle region : FITC
SKU
AVIARP57691_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes tissue-type plasminogen activator, a secreted serine protease which converts the proenzyme plasminogen to plasmin, a fibrinolytic enzyme. Tissue-type plasminogen activator is synthesized as a single chain which is cleaved by plasmin to a two chain disulfide linked protein. This enzyme plays a role in cell migration and tissue remodeling. Increased enzymatic activity causes hyperfibrinolysis, which manifests as excessive bleeding; decreased activity leads to hypofibrinolysis which can result in thrombosis or embolism. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLAT

Molecular Weight: 53kDa

Peptide Sequence: Synthetic peptide located within the following region: TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Tissue-type plasminogen activator

Protein Size: 516

Purification: Affinity Purified
More Information
SKU AVIARP57691_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57691_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5327
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×