PLDN Antibody - N-terminal region : FITC

PLDN Antibody - N-terminal region : FITC
SKU
AVIARP54889_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PLDN may play a role in intracellular vesicle trafficking. It interacts with Syntaxin 13 which mediates intracellular membrane fusion.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLDN

Key Reference: Stelzl,U., (2005) Cell 122 (6), 957-968

Molecular Weight: 20kDa

Peptide Sequence: Synthetic peptide located within the following region: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Biogenesis of lysosome-related organelles complex 1 subunit 6

Protein Size: 172

Purification: Affinity Purified
More Information
SKU AVIARP54889_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP54889_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 26258
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×