PLEKHA9 Antibody - middle region : Biotin

PLEKHA9 Antibody - middle region : Biotin
SKU
AVIARP56768_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLEKHA9

Key Reference: Ishibashi,T., (2005) J. Biochem. 137 (5), 617-623

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: EALLWLKRGLKFLKGFLTEVKNGEKDIQTALNNAYGKTLRQHHGWVVRGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Putative protein PLEKHA9

Protein Size: 391

Purification: Affinity Purified
More Information
SKU AVIARP56768_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56768_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51054
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×