PLSCR3 Antibody - middle region : Biotin

PLSCR3 Antibody - middle region : Biotin
SKU
AVIARP57395_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PLSCR3 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR3 may play a central role in the initiation of fibr

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLSCR3

Molecular Weight: 32kDa

Peptide Sequence: Synthetic peptide located within the following region: GCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phospholipid scramblase 3

Protein Size: 295

Purification: Affinity Purified
More Information
SKU AVIARP57395_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57395_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 57048
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×