PMM1 Antibody - N-terminal region : Biotin

PMM1 Antibody - N-terminal region : Biotin
SKU
AVIARP56401_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Phosphomannomutase catalyzes the conversion between D-mannose 6-phosphate and D-mannose 1-phosphate which is a substrate for GDP-mannose synthesis. GDP-mannose is used for synthesis of dolichol-phosphate-mannose, which is essential for N-linked glycosylat

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PMM1

Key Reference: Barone,R., J. Inherit. Metab. Dis. 30 (1), 107 (2007)

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: MAVTAQAARRKERVLCLFDVDGTLTPARQKIDPEVAAFLQKLRSRVQIGV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphomannomutase 1

Protein Size: 262

Purification: Affinity Purified
More Information
SKU AVIARP56401_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56401_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5372
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×