POLE3 Antibody - N-terminal region : FITC

POLE3 Antibody - N-terminal region : FITC
SKU
AVIARP58048_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. POLE3 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.[supplied by OMIM].

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POLE3

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: AERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA polymerase epsilon subunit 3

Protein Size: 147

Purification: Affinity Purified

Subunit: 3
More Information
SKU AVIARP58048_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58048_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54107
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×