POLR2C Antibody - C-terminal region : FITC

POLR2C Antibody - C-terminal region : FITC
SKU
AVIARP57690_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes the third largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. The product of this gene contains a cysteine rich region and exists as a heterodimer with another polymerase subunit, POLR2J. These two subunits form a core subassembly unit of the polymerase. A pseudogene has been identified on chromosome 21.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse POLR2C

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: YDPDNALRHTVYPKPEEWPKSEYSELDEDESQAPYDPNGKPERLGDLGPR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA-directed RNA polymerase II subunit RPB3

Protein Size: 332

Purification: Affinity Purified
More Information
SKU AVIARP57690_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57690_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5432
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×