POU2F3 Antibody - C-terminal region : Biotin

POU2F3 Antibody - C-terminal region : Biotin
SKU
AVIARP57992_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the POU domain family of transcription factors. POU domain transcription factors bind to a specific octamer DNA motif and regulate cell type-specific differentiation pathways. The encoded protein is primarily expressed in the epidermis, and plays a critical role in keratinocyte proliferation and differentiation. The encoded protein is also a candidate tumor suppressor protein, and aberrant promoter methylation of this gene may play a role in cervical cancer. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human POU2F3

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: LSVPPVHSTMPGTVTSSCSPGNNSRPSSPGSGLHASSPTASQNNSKAAVN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: POU domain, class 2, transcription factor 3

Protein Size: 221

Purification: Affinity Purified
More Information
SKU AVIARP57992_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57992_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25833
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×