PPID Antibody - N-terminal region : Biotin

PPID Antibody - N-terminal region : Biotin
SKU
AVIARP56624_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PPID is a member of the peptidyl-prolyl cis-trans isomerase (PPIase) family. PPIases catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides and accelerate the folding of proteins. This protein has been shown to possess PPIas

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PPID

Key Reference: Kajitani,K., (2008) Proteins 70 (4), 1635-1639

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: CPFHRIIKKFMIQGGDFSNQNGTGGESIYGEKFEDENFHYKHDREGLLSM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidyl-prolyl cis-trans isomerase D

Protein Size: 370

Purification: Affinity Purified
More Information
SKU AVIARP56624_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56624_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5481
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×