PPOX Antibody - C-terminal region : Biotin

PPOX Antibody - C-terminal region : Biotin
SKU
AVIARP56096_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes the penultimate enzyme of heme biosynthesis, which catalyzes the 6-electron oxidation of protoporphyrinogen IX to form protoporphyrin IX. Mutations in this gene cause variegate porphyria, an autosomal dominant disorder of heme metabolism resulting from a deficiency in protoporphyrinogen oxidase, an enzyme located on the inner mitochondrial membrane. Alternatively spliced transcript variants encoding the same protein have been identified.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PPOX

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: GGALHALPTGLRGLLRPSPPFSKPLFWAGLRELTKPRGKEPDETVHSFAQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: protoporphyrinogen oxidase

Protein Size: 158

Purification: Affinity Purified
More Information
SKU AVIARP56096_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56096_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5498
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×