PPP2R1A Antibody - middle region : Biotin

PPP2R1A Antibody - middle region : Biotin
SKU
AVIARP56742_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PPP2R1A is a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzy

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPP2R1A

Molecular Weight: 65kDa

Peptide Sequence: Synthetic peptide located within the following region: NVAKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform

Protein Size: 589

Purification: Affinity Purified

Subunit: A alpha isoform
More Information
SKU AVIARP56742_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56742_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5518
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×