Ppp2r2a Antibody - C-terminal region : FITC

Ppp2r2a Antibody - C-terminal region : FITC
SKU
AVIARP56158_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Human homolog forms a complex with cyclin G2 that may inhibit cell cycle progression.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ppp2r2a

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: ASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKILHTAWHPKENI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform

Protein Size: 447

Purification: Affinity Purified

Subunit: B alpha isoform
More Information
SKU AVIARP56158_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56158_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 117104
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×