Ppp3cb Antibody - middle region : Biotin

Ppp3cb Antibody - middle region : Biotin
SKU
AVIARP57515_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Ppp3cb is a Calcium-dependent, calmodulin-stimulated protein phosphatase. This subunit may have a role in the calmodulin activation of calcineurin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Ppp3cb

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: MCDLLWSDPSEDFGNEKSQEHFSHNTVRGCSYFYNYPAVCEFLQNNNLLS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Serine/threonine-protein phosphatase 2B catalytic subunit beta isoform

Protein Size: 525

Purification: Affinity Purified

Subunit: beta isoform
More Information
SKU AVIARP57515_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57515_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 24675
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×