PPP4R3A Antibody - middle region : Biotin

PPP4R3A Antibody - middle region : Biotin
SKU
AVIARP57688_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SMEK1

Molecular Weight: 94kDa

Peptide Sequence: Synthetic peptide located within the following region: YWKALEDVDYVQTFKGLKLRFEQQRERQDNPKLDSMRSILRNHRYRRDAR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: serine/threonine-protein phosphatase 4 regulatory subunit 3A

Protein Size: 820

Purification: Affinity Purified

Subunit: 3A
More Information
SKU AVIARP57688_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57688_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55671
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×