PPP5C Antibody - middle region : HRP

PPP5C Antibody - middle region : HRP
SKU
AVIARP56696_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: PPP5C may play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, PPP5C dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPP5C

Molecular Weight: 57kDa

Peptide Sequence: Synthetic peptide located within the following region: AEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Serine/threonine-protein phosphatase 5

Protein Size: 499

Purification: Affinity Purified
More Information
SKU AVIARP56696_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56696_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5536
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×