Preb Antibody - N-terminal region : Biotin

Preb Antibody - N-terminal region : Biotin
SKU
AVIARP57930_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Preb was first identified based on its probable role in the regulation of pituitary gene transcription. It binds to the prolactin gene (PRL) promoter and seems to activate transcription. Guanine nucleotide exchange factor that activates SARA2. It is also required for the formation of COPII transport vesicles from the ER.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Preb

Molecular Weight: 45kDa

Peptide Sequence: Synthetic peptide located within the following region: RRRGVELYRAPFPLYALRIDPKTGLLIAAGGGGAAKTGIKNGVHFLQLEL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Prolactin regulatory element-binding protein

Protein Size: 417

Purification: Affinity Purified
More Information
SKU AVIARP57930_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57930_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 50907
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×