PRKACB Antibody - N-terminal region : Biotin

PRKACB Antibody - N-terminal region : Biotin
SKU
AVIARP56415_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: cAMP is a signaling molecule important for a variety of cellular functions. cAMP exerts its effects by activating the cAMP-dependent protein kinase, which transduces the signal through phosphorylation of different target proteins. The inactive kinase holoenzyme is a tetramer composed of two regulatory and two catalytic subunits. cAMP causes the dissociation of the inactive holoenzyme into a dimer of regulatory subunits bound to four cAMP and two free monomeric catalytic subunits. Four different regulatory subunits and three catalytic subunits have been identified in humans. The protein encoded by this gene is a member of the Ser/Thr protein kinase family and is a catalytic subunit of cAMP-dependent protein kinase.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKACB

Molecular Weight: 28kDa

Peptide Sequence: Synthetic peptide located within the following region: MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-dependent protein kinase catalytic subunit beta

Protein Size: 257

Purification: Affinity Purified

Subunit: beta
More Information
SKU AVIARP56415_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56415_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5567
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×