Prkar1a Antibody - N-terminal region : FITC

Prkar1a Antibody - N-terminal region : FITC
SKU
AVIARP57831_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Prkar1a is a regulatory subunit of cAMP-dependent protein kinase (PKA); negatively regulates meiosis .

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Prkar1a

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: REYFERLEKEEARQIQSLQKSGIRTDSREDEISPPPPNPVVKGRRRRGAI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-dependent protein kinase type I-alpha regulatory subunit

Protein Size: 381

Purification: Affinity Purified
More Information
SKU AVIARP57831_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57831_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 25725
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×