PRKX Antibody - N-terminal region : FITC

PRKX Antibody - N-terminal region : FITC
SKU
AVIARP56626_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a serine threonine protein kinase that has similarity to the catalytic subunit of cyclic AMP dependent protein kinases. The encoded protein is developmentally regulated and may be involved in renal epithelial morphogenesis. This protein

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKX

Key Reference: Li,X., (2008) Biochim. Biophys. Acta 1782 (1), 1-9

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: MEAPGLAQAAAAESDSRKVAEETPDGAPALCPSPEALSPEPPVYSLQDFD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: cAMP-dependent protein kinase catalytic subunit PRKX

Protein Size: 358

Purification: Affinity Purified
More Information
SKU AVIARP56626_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56626_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Rat (Rattus)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5613
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×