PROSER2 Antibody - C-terminal region : Biotin

PROSER2 Antibody - C-terminal region : Biotin
SKU
AVIARP55576_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PROSER2

Molecular Weight: 26kDa

Peptide Sequence: Synthetic peptide located within the following region: LCFRPGPALPSTRARQSFPGPRQPNGAQDWRRADSLPRPQGITVQFAGRG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: proline and serine-rich protein 2

Protein Size: 239

Purification: Affinity Purified
More Information
SKU AVIARP55576_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55576_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human
Clonality Polyclonal
Application Western Blotting
Human Gene ID 254427
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×