PRR13 Antibody - middle region : Biotin

PRR13 Antibody - middle region : Biotin
SKU
AVIARP57260_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: PRR13 negatively regulates TSP1 expression at the level of transcription. This down-regulation was shown to reduce taxane-induced apoptosis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRR13

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: PFPPGPCPPPPGAPHGNPAFPPGGPPHPVPQPGYPGCQPLGPYPPPYPPP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proline-rich protein 13

Protein Size: 148

Purification: Affinity Purified
More Information
SKU AVIARP57260_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57260_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 54458
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×