PRR16 Antibody - middle region : Biotin

PRR16 Antibody - middle region : Biotin
SKU
AVIARP56956_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PRR16

Key Reference: Barberi,T., PLoS Med. 2 (6), E161 (2005)

Molecular Weight: 30kDa

Peptide Sequence: Synthetic peptide located within the following region: RERVRFNEKVQYHGYCPDCDTRYNIKNREVHLHSEPVHPPGKIPHQGPPL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proline-rich protein 16

Protein Size: 281

Purification: Affinity Purified
More Information
SKU AVIARP56956_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56956_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51334
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×