PRR5 Antibody - N-terminal region : HRP

PRR5 Antibody - N-terminal region : HRP
SKU
AVIARP56749_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein with a proline-rich domain. This gene is located in a region of chromosome 22 reported to contain a tumor suppressor gene that may be involved in breast and colorectal tumorigenesis. Rare read-through transcripts, containing exons from the ARHGAP8 gene which is located immediately downstream, led to the original description of PRR5 and ARHGAP8 as a single gene. Alternative splicing and the use of alternative promoters results in transcripts encoding different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRR5

Molecular Weight: 41kDa

Peptide Sequence: Synthetic peptide located within the following region: NSIHNGVIAVFQRKGLPDQELFSLNEGVRQLLKTELGSFFTEYLQNQLLT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: cDNA FLJ34565 fis, clone KIDNE2006210, highly similar to Homo sapiens proline rich protein 5 (PRR5), transcript variant 1, mRNA EMBL BAG52436.1

Protein Size: 379

Purification: Affinity Purified
More Information
SKU AVIARP56749_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56749_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 55615
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×