PRSS21 Antibody - N-terminal region : Biotin

PRSS21 Antibody - N-terminal region : Biotin
SKU
AVIARP53665_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a cell-surface anchored serine protease, which is a member of the trypsin family of serine proteases. It is predicted to be active on peptide linkages involving the carboxyl group of lysine or arginine. The protein localizes to the cytoplasm and the plasma membrane of premeiotic testicular germ cells and it may be involved in progression of testicular tumors of germ cell origin. Alternative splicing of this gene results in three transcript variants encoding three different isoforms.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRSS21

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: RRVITSRIVGGEDAELGRWPWQGSLRLWDSHVCGVSLLSHRWALTAAHCF

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Testisin

Protein Size: 300

Purification: Affinity Purified
More Information
SKU AVIARP53665_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP53665_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig
Clonality Polyclonal
Application Western Blotting
Human Gene ID 10942
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×