Psma2 Antibody - C-terminal region : Biotin

Psma2 Antibody - C-terminal region : Biotin
SKU
AVIARP56454_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Psma2 is a component of the proteasome multicatalytic proteinase complex.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Psma2

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: TQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proteasome subunit alpha type-2

Protein Size: 234

Purification: Affinity Purified

Subunit: alpha type-2
More Information
SKU AVIARP56454_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56454_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 29669
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×