PSMB10 Antibody - middle region : Biotin

PSMB10 Antibody - middle region : Biotin
SKU
AVIARP56474_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PSMB10

Key Reference: Liu,Y., (2007) DNA Seq. 18 (4), 257-264

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: DLTGPQLYGVHPHGSYSRLPFTALGSGQDAALAVLEDRFQPNMTLEAAQG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proteasome subunit beta type-10

Protein Size: 273

Purification: Affinity Purified

Subunit: beta type-10
More Information
SKU AVIARP56474_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56474_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5699
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×