PSPH Antibody - middle region : FITC

PSPH Antibody - middle region : FITC
SKU
AVIARP56589_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene belongs to a subfamily of the phosphotransferases. This encoded enzyme is responsible for the third and last step in L-serine formation. It catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved i

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PSPH

Key Reference: Ewing,R.M., Mol. Syst. Biol. 3, 89 (2007)

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: IMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phosphoserine phosphatase

Protein Size: 225

Purification: Affinity Purified
More Information
SKU AVIARP56589_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56589_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5723
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×