PTPN14 Antibody - N-terminal region : FITC

PTPN14 Antibody - N-terminal region : FITC
SKU
AVIARP56641_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP contains an N-terminal noncatalytic domain similar to that of band 4.1 superfamily cytoskeleton-associated proteins, which suggested the membrane or cytoskeleton localization of this protein. It appears to regulate lymphatic development in mammals, and a loss of function mutation has been found in a kindred with a lymphedema-choanal atresia.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of mouse PTPN14

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: HVQCSEHYSETHTSQDSIFPGNEEALYCRSHNSLDLNYLNGTVTNGSVCS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tyrosine-protein phosphatase non-receptor type 14

Protein Size: 472

Purification: Affinity Purified
More Information
SKU AVIARP56641_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56641_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5784
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×