RAB15 Antibody - middle region : FITC

RAB15 Antibody - middle region : FITC
SKU
AVIARP55918_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAB15 may act in concert with RAB3A in regulating aspects of synaptic vesicle membrane flow within the nerve terminal.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB15

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: QTITKQYYRRAQGIFLVYDISSERSYQHIMKWVSDVDEVGDATSLPGCGE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-15

Protein Size: 208

Purification: Affinity Purified
More Information
SKU AVIARP55918_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55918_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 376267
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×