RAB1A Antibody - middle region : Biotin

RAB1A Antibody - middle region : Biotin
SKU
AVIARP56561_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multipl

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB1A

Key Reference: Diao,A., (2008) J. Biol. Chem. 283 (11), 6957-6967

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-1A

Protein Size: 205

Purification: Affinity Purified
More Information
SKU AVIARP56561_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56561_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5861
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×