RAB1A Antibody - middle region : HRP

RAB1A Antibody - middle region : HRP
SKU
AVIARP56561_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a member of the Ras superfamily of GTPases. Members of the gene family cycle between inactive GDP-bound and active GTP-bound forms. This small GTPase controls vesicle traffic from the endoplasmic reticulum to the Golgi apparatus. Multipl

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB1A

Key Reference: Diao,A., (2008) J. Biol. Chem. 283 (11), 6957-6967

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: AKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Ras-related protein Rab-1A

Protein Size: 205

Purification: Affinity Purified
More Information
SKU AVIARP56561_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56561_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5861
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×