RAB22A Antibody - middle region : Biotin

RAB22A Antibody - middle region : Biotin
SKU
AVIARP57434_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the RAB family of small GTPases. The GTP-bound form of the encoded protein has been shown to interact with early-endosomal antigen 1, and may be involved in the trafficking of and interaction between endosom

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB22A

Molecular Weight: 22kDa

Peptide Sequence: Synthetic peptide located within the following region: IFVETSAKNAININELFIEISRRIPSTDANLPSGGKGFKLRRQPSEPKRS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-22A

Protein Size: 194

Purification: Affinity Purified
More Information
SKU AVIARP57434_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57434_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 57403
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×