RAB27A Antibody - middle region : Biotin

RAB27A Antibody - middle region : Biotin
SKU
AVIARP56591_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction. Mutations in this gene are associated with Griscell

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAB27A

Key Reference: Chiaverini,C., (2008) J. Biol. Chem. 283 (18), 12635-12642

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-27A

Protein Size: 221

Purification: Affinity Purified
More Information
SKU AVIARP56591_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56591_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Cow (Bovine), Goat (Caprine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5873
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×