RAB5B Antibody - N-terminal region : FITC

RAB5B Antibody - N-terminal region : FITC
SKU
AVIARP56499_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RAB5B play a role in protein transport. RAB5B is probably involved in vesicular traffic.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RAB5B

Key Reference: Hirota,Y., (2007) Biochem. Biophys. Res. Commun. 364 (1), 40-47

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: MTSRSTARPNGQPQASKICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-5B

Protein Size: 215

Purification: Affinity Purified
More Information
SKU AVIARP56499_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56499_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5869
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×