Rab9b Antibody - N-terminal region : Biotin

Rab9b Antibody - N-terminal region : Biotin
SKU
AVIARP56895_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: Rab9b may be involved in the transport of proteins between the endosomes and the trans Golgi network.

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: LQIWDTAGQERFKSLRTPFYRGADCCLLTFSVDDRQSFENLGNWQKEFIY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-related protein Rab-9B

Protein Size: 201

Purification: Affinity Purified
More Information
SKU AVIARP56895_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56895_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 319642
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×