RAD23B Antibody - middle region : Biotin

RAD23B Antibody - middle region : Biotin
SKU
AVIARP56505_P050-Btn
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is one of two human homologs of Saccharomyces cerevisiae Rad23, a protein involved in the nucleotide excision repair (NER). This protein was found to be a component of the protein complex that specifically complements the NER defect of xeroderma pigmentosum group C (XP-c) cell extracts in vitro. This protein was also shown to interact with, and elevate the nucleotide excision activity of 3-methyladenine-DNA glycosylase (MPG), which suggested a role in DNA damage recognition in base excision repair. This protein contains an N-terminal ubiquitin-like domain, which was reported to interact with 26S proteasome, and thus this protein may be involved in the ubiquitin mediated proteolytic pathway in cells.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAD23B

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: QSSAVAAAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNPSLLP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: UV excision repair protein RAD23 homolog B

Protein Size: 409

Purification: Affinity Purified
More Information
SKU AVIARP56505_P050-Btn
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56505_P050-Biotin
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Western Blotting, Immunohistochemistry
Human Gene ID 5887
Host Rabbit
Conjugate Conjugated, Biotin
Product information (PDF) Download
MSDS (PDF)
×