RAN Antibody - middle region : HRP

RAN Antibody - middle region : HRP
SKU
AVIARP56714_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: RAN (ras-related nuclear protein) is a small GTP binding protein belonging to the RAS superfamily that is essential for the translocation of RNA and proteins through the nuclear pore complex. The RAN protein is also involved in control of DNA synthesis an

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAN

Key Reference: Abe,H., (2008) Int. J. Cancer 122 (10), 2391-2397

Molecular Weight: 24kDa

Peptide Sequence: Synthetic peptide located within the following region: NLQYYDISAKSNYNFEKPFLWLARKLIGDPNLEFVAMPALAPPEVVMDPA

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: GTP-binding nuclear protein Ran

Protein Size: 216

Purification: Affinity Purified
More Information
SKU AVIARP56714_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56714_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5901
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×