RASGEF1A Antibody - N-terminal region : FITC

RASGEF1A Antibody - N-terminal region : FITC
SKU
AVIARP55468_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RASGEF1A is the guanine nucleotide exchange factor (GEF) for KRAS, HRAS, and NRAS (in vitro). It plays a role in cell migration.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RASGEF1A

Key Reference: Burzynski,G.M., (2005) Am. J. Hum. Genet. 76 (5), 850-858

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: TFLLSSRVFMPPHDLLARVGQICVEQKQQLEAGPEKAKLKSFSAKIVQLL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ras-GEF domain-containing family member 1A

Protein Size: 481

Purification: Affinity Purified
More Information
SKU AVIARP55468_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP55468_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 221002
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×