Products from BPS Bioscience require a minimum order value above 400€
Amino Acid Sequence: MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Application: Useful for the study of in vitro and in vivo protein function.
Biological Activity: Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 4.0 - 8.0 ng/ml.
Description: Recombinant rat vascular endothelial growth factor A (VEGF-A) expressed in E. coli cells. Rat recombinant VEGF-A contains 165 amino acids and has a molecular weight of 38.7 kDa. VEGF is an important growth factor involved in both vasculogenesis and angiogenesis.
Format: Lyophilized solid
Formulation: Recombinant rat VEGFlyophilized from 10 mM Na Phosphate,pH 7.5.
Genbank: AF080594.1
Reconstitution: Briefly centrifuge the vial, followed by reconstitution in distilled water to a concentration of ≥0.1 mg/ml. This solution can then be further diluted into other buffers containing carrier protein (0.1% BSA).
Storage Stability: The lyophilized protein isstable at room temperature for 3 weeksand for at least 2 years from date ofreceipt when stored at -20°C. Uponreconstitution, store in working aliquotsat 2 - 8° C for up to one week, or at-20°C for up to six months, in thepresence of a carrier protein. Avoidrepeated freeze/thaw cycles.
Biosafety Level: Not applicable (BSL-1)
References: 1. Reproduction. 2009; 138: 667-677.
2. Ann. Onc. 2009; 20: 1639-1646.