Rat VEGF-A Recombinant

Rat VEGF-A Recombinant
SKU
BPS91008
Packaging Unit
10 µg
Manufacturer
BPS Bioscience

Availability: loading...
Price is loading...
Products from BPS Bioscience require a minimum order value above 400€

Amino Acid Sequence: MAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Applications: Useful for the study of in vitro and in vivo protein function.

Biological Activity: Determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC) using a concentration range of 4.0 - 8.0 ng/ml.

Description: Recombinant rat vascular endothelial growth factor A (VEGF-A) expressed in E. coli cells. Rat recombinant VEGF-A contains 165 amino acids and has a molecular weight of 38.7 kDa. VEGF is an important growth factor involved in both vasculogenesis and angiogenesis.

Format: Lyophilized powder

Formulation: Recombinant rat VEGFlyophilized from 10 mM Na Phosphate,pH 7.5.

Genbank: AF080594.1

Reconstitution: Briefly centrifuge the vial, followed by reconstitution in distilled water to a concentration of ≥0.1 mg/ml. This solution can then be further diluted into other buffers containing carrier protein (0.1% BSA).

Storage Stability: The lyophilized protein isstable at room temperature for 3 weeksand for at least 2 years from date ofreceipt when stored at -20°C. Uponreconstitution, store in working aliquotsat 2 - 8° C for up to one week, or at-20°C for up to six months, in thepresence of a carrier protein. Avoidrepeated freeze/thaw cycles.

Biosafety Level: Not applicable (BSL-1)

References: 1. Reproduction. 2009; 138: 667-677.
2. Ann. Onc. 2009; 20: 1639-1646.
More Information
SKU BPS91008
Manufacturer BPS Bioscience
Manufacturer SKU 91008
Green Labware No
Package Unit 10 µg
Quantity Unit STK
Product information (PDF) Download
MSDS (PDF)
×