RB1 Antibody - middle region : HRP

RB1 Antibody - middle region : HRP
SKU
AVIARP58066_P050-HRP
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The protein encoded by this gene is a negative regulator of the cell cycle and was the first tumor suppressor gene found. The encoded protein also stabilizes constitutive heterochromatin to maintain the overall chromatin structure. The active, hypophospho

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RB1

Molecular Weight: 106kDa

Peptide Sequence: Synthetic peptide located within the following region: AEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQKLAEMTSTRTRMQ

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Retinoblastoma-associated protein

Protein Size: 928

Purification: Affinity Purified
More Information
SKU AVIARP58066_P050-HRP
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP58066_P050-HRP
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 5925
Host Rabbit
Conjugate Conjugated, HRP
Product information (PDF) Download
MSDS (PDF)
×