RBJ Antibody - middle region : FITC

RBJ Antibody - middle region : FITC
SKU
AVIARP56938_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The exact function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RBJ

Key Reference: von (2004) Gene 327 (2), 221-232

Molecular Weight: 31kDa

Peptide Sequence: Synthetic peptide located within the following region: CVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DnaJ homolog subfamily C member 27

Protein Size: 273

Purification: Affinity Purified
More Information
SKU AVIARP56938_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP56938_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
Clonality Polyclonal
Application Western Blotting
Human Gene ID 51277
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×