RCC2 Antibody - middle region : FITC

RCC2 Antibody - middle region : FITC
SKU
AVIARP57290_P050FITC
Packaging Unit
100μl
Manufacturer
Aviva Systems Biology

Availability: loading...
Price is loading...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: RCC2 is required for completion of mitosis and cytokinesis. RCC2 may function as a guanine nucleotide exchange factor for the small GTPase RAC1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RCC2

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 56kDa

Peptide Sequence: Synthetic peptide located within the following region: RIRSLACGKSSIIVAADESTISWGPSPTFGELGYGDHKPKSSTAAQEVKT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein RCC2

Protein Size: 522

Purification: Affinity Purified
More Information
SKU AVIARP57290_P050FITC
Manufacturer Aviva Systems Biology
Manufacturer SKU ARP57290_P050-FITC
Package Unit 100μl
Quantity Unit STK
Reactivity Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Clonality Polyclonal
Application Immunoprecipitation, Western Blotting
Human Gene ID 55920
Host Rabbit
Conjugate Conjugated, FITC
Product information (PDF) Download
MSDS (PDF)
×